PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_9970V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 478aa    MW: 52420.1 Da    PI: 6.8221
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_9970V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.4e-191461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+eEd++lvd+++++G g+W++ +++ g+ R++k+c++rw +yl
  Pp3c16_9970V3.1.p 14 KGPWTPEEDQKLVDYIQRFGHGSWRALPKHAGLSRCGKSCRLRWTNYL 61
                       79********************************************97 PP

2Myb_DNA-binding50.74.1e-1667112148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg ++ eE++ +++++ +lG++ W++Ia++++ gRt++++k++w+++l
  Pp3c16_9970V3.1.p  67 RGQFSFEEEQVIIHLHGLLGNR-WSAIAAYLP-GRTDNEIKNHWNTHL 112
                        899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.289961IPR017930Myb domain
SuperFamilySSF466894.87E-3210108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002492.9E-171461IPR001005SANT/Myb domain
CDDcd001674.19E-121661No hitNo description
PROSITE profilePS5129426.22362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-2565116IPR009057Homeodomain-like
SMARTSM007172.6E-1566114IPR001005SANT/Myb domain
PfamPF002499.2E-1567112IPR001005SANT/Myb domain
CDDcd001671.41E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MVRAPCCDKM GLKKGPWTPE EDQKLVDYIQ RFGHGSWRAL PKHAGLSRCG KSCRLRWTNY  60
LRPDIKRGQF SFEEEQVIIH LHGLLGNRWS AIAAYLPGRT DNEIKNHWNT HLKKRLLQMG  120
IDPVTHKEKS NLLLDNMELK PIVCSTLTHM SQWDRVRMET EARLANNYTK LASQATQGYS  180
CCASPGLSGD ASVRHWKTQI SESLLRREFG RGLERSASAS IELPAILQDW EEELLHGQAL  240
DASLYNSPIS ETPSSSLSDC SQTRFDTQAD STSRFQTFPN FQETPSPAAL PQQAADVVCA  300
APTNCGLFTN PYTEPKTQSS IISTEQLMSP TSTLSSPFGT TPLDFLLPSS SASCDLAFSP  360
SRASETVQLP SPTFWTVPAS LPTSSSQASD PAGRAEAAPH SAEGLMQIPS EILMELQEPS  420
LIPPPKAVAA PATRASPGWS GYGVLESKDY WTNMLHLVGS TSHQPYLSFC APAGLTR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-33121165108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S106_224V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.12e-83myb domain protein 16